PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v0214740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB_related
Protein Properties Length: 547aa    MW: 62292.6 Da    PI: 6.3197
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v0214740.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.81.9e-11106146445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++E+ ll++++  +G g+W+ +a+++g +++  qc+++++
  Lj6g3v0214740.1 106 WNADEEMLLLEGIGTYGFGNWSEVAEYVG-TKSKAQCIDHYN 146
                      *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250242.0E-15133547IPR016827Transcriptional adaptor 2
SMARTSM002914.0E-104287IPR000433Zinc finger, ZZ-type
CDDcd023354.72E-254694No hitNo description
SuperFamilySSF578504.47E-1346109No hitNo description
PfamPF005697.1E-84678IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.4864689IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135704875IPR000433Zinc finger, ZZ-type
SuperFamilySSF466893.81E-1299152IPR009057Homeodomain-like
PROSITE profilePS5129321.044101153IPR017884SANT domain
SMARTSM007176.2E-11102151IPR001005SANT/Myb domain
PfamPF002492.8E-11105146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-8106148IPR009057Homeodomain-like
CDDcd001671.58E-10106146No hitNo description
SuperFamilySSF466893.05E-18456545IPR009057Homeodomain-like
PROSITE profilePS5093410.148464547IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009409Biological Processresponse to cold
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MGRCRAASRS ADDDPRSKKK KATLNVENLE TSSAGQEISD GKASLYHCNY CHKDISGKIR  60
IKCAVCQDFD LCIECFSVGV EVTPHKCNHP YRIMDNLSFP LICPDWNADE EMLLLEGIGT  120
YGFGNWSEVA EYVGTKSKAQ CIDHYNAVYM NSPCFPLPDL SHVMGKSREE LLAMAKEHEA  180
KKEFPPTAEL TLKEEAPFSD GINSEESTKV GTTNQTMSRL TSARDKAYSS AIKMASKMSQ  240
NNDGVKVEVE HQAGRSIGEK KPKFSGEDRP YMTEFSGYNF KREEFEIEYD NDAEQVLADM  300
EFKDTDTEAE CETKLRVLHI YSKRLDERKR RKNFILERNL LCPDPFEKSL SPEELQICQR  360
YKVLMRFQSD EQHRELLKNI IEEHRLVKRI QDLQEARLAG CVTAAKAQEF IEHKRTKEAE  420
EKGCKGIGHI GTGAKTLQKS NYLKGELDSS LQGLHKDSRP TVMEAITRSL EEWDISGFEG  480
AELLSESEKK LCNENRILPS HYLKMLQIMS LEISEGRVTN KSDAHRLFKV EPSKVDRVYD  540
MLVKKQG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.211310.0floral bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1488122e-98BT148812.1 Lotus japonicus clone JCVI-FLLj-2I16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593862.10.0PREDICTED: transcriptional adapter ADA2a-like isoform X5
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
SwissprotQ9SFD50.0TAD2A_ARATH; Transcriptional adapter ADA2a
TrEMBLA0A0R0GGU10.0A0A0R0GGU1_SOYBN; Uncharacterized protein
STRINGGLYMA13G11200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726